Loading presentation...

Present Remotely

Send the link below via email or IM

Copy

Present to your audience

Start remote presentation

  • Invited audience members will follow you as you navigate and present
  • People invited to a presentation do not need a Prezi account
  • This link expires 10 minutes after you close the presentation
  • A maximum of 30 users can follow your presentation
  • Learn more about this feature in our knowledge base article

Do you really want to delete this prezi?

Neither you, nor the coeditors you shared it with will be able to recover it again.

DeleteCancel

Make your likes visible on Facebook?

Connect your Facebook account to Prezi and let your likes appear on your timeline.
You can change this under Settings & Account at any time.

No, thanks

Introducción Bionformatica

Clase 1
by

ALEJANDRO HERNANDEZ

on 3 August 2016

Comments (0)

Please log in to add your comment.

Report abuse

Transcript of Introducción Bionformatica

2016
Prof.
ALEJANDRO HERNANDEZ
DAVID GARCIA/ KAROL JIMENEZ

BIOINFORMATICA
PRESENTACION

Alejandro Hernández
alejandro.hernandez.s@gmail.com
bioinformatica.itcr@gmail.com

David Garcia
davidgg04@gmail.com

Karol Jimenez
karol.jq90@gmail.com

1) El tema de investigación lo deben definir en un máximo de tres semanas.

2) En vista del horario inflexible del lugar en el que trabajo, el horario de consulta será el mismo día de clase posterior o mediante consultas en línea mediante g-mail, Skype o Messenger. Si así lo requieren después de las 5 el Lunes o el Jueves, previa solicitud verbal o escrita.

3) Los exámenes son para la casa
ADMINISTRATIVO

Receptores de Estrógeno >Cancer > Droga tamoxifen
Esteroides anabólicos > androstenedione, Dihydroepiandrostenone (DHEA) y  tetrahydrogestrinone (THG)
MOTORES MOLECULARES: Kinesina
Ras Protein > Comportamiento como Oncogen >CANCER
Bacteriorhodopsin > Uso de la luz en Bacterias
EPIGENETICA> DNA Methyltransferases
Caries y las Glucansucrase
VIH y las Integrase
Tráfico dentro de la celula> Clathrin
Diabetes> Glucose Oxidase
Cambios en proteínas > Inteins
Anticuerpos de Camellos> Nanobodies
Vitamina C, Huesos, dientes> Collagen
Helados mas fríos> Proteína anticongelante
(>1KDEMNQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYAAKDEL)
TEMAS:
REPASO GENERAL
Conceptos
BIOINFORMATICA
MACROMOLECULAS
ADN-ARN-PROTEINAS
DOGMA DE BIOINFORMATICA
GENOMAS
De dónde viene la Información?

Información
Macromoléculas

De dónde
Viene?

Para los británicos la bioinformática se extiende al estudio de cualquier tipo de dato obtenido de entidades biológicas desde de moléculas hasta paisaje, ecosistemas, etc.
BIOINFORMATICA
RAMA DE LA BIOLOGÍA COMPUTACIONAL
INFORMACIÓN
(ADN, ARN, Proteínas)
Aplicación de las tecnologías de la información
para:
1-Almacenar, mantener y distribuir
2- Buscar
3- Manipular
RESOLVER PROBLEMAS
Bioinformática es la aplicación del desarrollo de la computación y las matemáticas que permite la administración, análisis y comprensión de datos para resolver preguntas biológicas
MACROMOLÉCULAS
MACROMOLÉCULAS
INFORMACIÓN
(ADN, ARN, Proteínas)
EXCEPCIONES

Splicing alternativo

miRNA

RNA catalítico
ORIGEN DE REPLICACIÓN
Helicasas
SSBP (Single Strand Binding protein)
Primasa
Polimerasa 3 (duplicada)
Cadena Líder
Rezagada (Fragmentos de Okasaky-Polimerasa I-Ligasa)

La adición de nucleótidos ocurre de 5’ a 3’
La polimerasa añade nucleótidos a partir de un ADN complementario.
REPLICACIÓN
COPIAR EL ADN
Sitios de inicio "Promotores y enhancers"
TFIID contiene tata binding protein
TFIIA, TFIIB (importantes para iniciar)
RNA polimerasa (copia de 5-3')
ATP
TRANSCRIPCIÓN
DE ADN A ARNm
TRADUCCION
Adición de un Oligosacárido
Hidrolasas y Glicosilación
Modificación hasta Manosa 6P

-LÍPIDOS
MODIFICACIONES
MODIFICACIONES
Spliceosoma
GU ---------------A- Pirimidinas------AG
snRNP: U1 BBP-U2A
U2
U5/U4/U6
Spliceosoma
CAP:7Metil Guanosil (CPB20/80)
AUAA----GGUUUGUUGGUU
Cleavage Factors/Stabilizing factors
Poli A (proteínas estabilizadoras)
CAP-PoliA
Tripletas: Codones.
Varias tripletas codifican para un mismo aminoácido
Hay organismos que usan diferentes codones “codon usage”
Marco Abierto de Lectura (ORF: Open reading Frame)
Cada secuencia tiene 6 marcos de lectura)
Optimización
GENÓMICA
ADN-ARN-Proteinas
El término actual comprende todas las relaciones biológicas referentes al genoma y otros términos como:
Genómica funcional: análisis de la función de genes.
Transcriptómica: Análisis de expresión de ARNm
Proteómica: análisis de proteínas (expresión, interacción y estructura)
GENOMICA
Fig. Desarrollo del GenBank. Tomado de Selzer P, Marhöfer R and Rohwer A. 2008. Applied Bioinformatics
GENOMA
El término genoma se introdujo en 1920 por el botánico alemán Hans Winkler como la colección total de ADN en una célula haploide que contiene la totalidad de los cromosomas.

El término actual comprende todo el ADN aunque no contenga Genes.

En eucariotas la densidad de genes es baja. Ej. Solo el 2-3% del genoma humano contiene genes.
PROMOTORES
a-tropomyosin
GENOMA HUMANO

3,000 Mb
90 Mb (3%) corresponds to coding sequences
810 Mb (27%) corresponds to associated sequences (introns, promoters, pseudogenes)
2,100 Mb (70%) junk DNA
Unique sequences (1,680 Mb - 56%)
repetitive DNA (420 Mb - 14%)


En la proteómica se monitorean las proteínas en sí.
En la genómica se monitorean los genes y la traducción.
MUNDO DE LA INFORMACION
UN TEMA DE INTERÉS DE BIOINFORMATICA
-Antecedentes Técnicos
-Forma de uso del sitio
-Laboratorio corto de uso
-Bases de datos de VIH, miRNA, Cancer, DNA Vaccines, farmacogenética, Aptámeros, DNA nanostructures, etc
Bioinformatics
Is the development and application of
computational tools
in managing all kinds of biological data

involves the technology
that uses computers for storage, retrieval, manipulation, and distribution of information related to biological macromoleculates such as DNA, RNA, proteins and metabolites

generally limited
to sequence, structural, and functional analysis of genes and genomes and their corresponding products
• sometimes called computational molecular biology

This field has developed over the past decade or so to help manage the huge increase in data generated by genome sequencing projects, highthroughput technologies etc.

Xiong (2006) Essential Bioinformatics, Cambridge University Press.
PCR, Secuenciación
PCR
Secuenciación Sanger
5' UTR 300bp 3' UTR 770bp





Exon 145bp, Número 8.8 Intrones 3365bp

Coding Sequence 1340bp CDS 447aa Genomic extent 27kb

STS: Sequence Tag Site
Es una región corta (200 to 500 base pairs) irrepetible de ADN que sirve como referencia para el ensamblaje de un Genoma.

Sirven puntos de referencia para localizar y orientar una secuencia de DNA reportada por distintos laboratorios

Un EST (Expressed sequence tags) puede ser un STS, pero no todos los STS son EST

Si desean aprender más sobre el proceso de Extravasión:
http://multimedia.mcb.harvard.edu/anim_extravasation.html
Base de
Datos
Relación


Objetos



"Make a Query" Hacemos una Solicitud

Full transcript